PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g44070.1.p
Common NameBRADI_1g44070, LOC100843421
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 252aa    MW: 28218.3 Da    PI: 6.0909
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g44070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.32e-141461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++lv+    +   +W+ I++  g+ R++k+c++rw +yl
  Bradi1g44070.1.p 14 KGPWTAEEDQKLVRFLLTHDHYCWRVIPKLAGLLRCGKSCRLRWINYL 61
                      79******************99**********99************97 PP

2Myb_DNA-binding54.82.2e-1770111447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        + eE++l +d++ qlG++ W++Ia+ ++ gRt++++k++w+++
  Bradi1g44070.1.p  70 LSDEEEKLVIDLHMQLGNR-WSKIAAQLP-GRTDNEIKNHWNTH 111
                       589****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-20562IPR009057Homeodomain-like
PROSITE profilePS5129413.343961IPR017930Myb domain
SuperFamilySSF466897.49E-2711108IPR009057Homeodomain-like
SMARTSM007172.7E-121363IPR001005SANT/Myb domain
PfamPF002496.9E-131461IPR001005SANT/Myb domain
CDDcd001672.94E-101661No hitNo description
PROSITE profilePS5129426.3562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.2E-2563116IPR009057Homeodomain-like
SMARTSM007173.4E-1566114IPR001005SANT/Myb domain
PfamPF002494.5E-1570111IPR001005SANT/Myb domain
CDDcd001676.04E-1371112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLVRFLL THDHYCWRVI PKLAGLLRCG KSCRLRWINY  60
LRPDIKRGLL SDEEEKLVID LHMQLGNRWS KIAAQLPGRT DNEIKNHWNT HIKKKLRRMG  120
IDPVTHLPMQ EIHPLEQPRQ QQPSSQLDDA ELSLRLDNED EKAIVPMIQP PQEITAVPPP  180
KGNCSTTFGM DVADCPEPMC LSGIGMDGIT EAGWDSFAYG GLGVDPFDQY YPGGGFDPTG  240
SDAILGTLHI D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1074831e-147AK107483.1 Oryza sativa Japonica Group cDNA clone:002-129-C06, full insert sequence.
GenBankFJ9402171e-147FJ940217.1 Oryza sativa Japonica Group clone KCS132B07 Myb related transcription factor mRNA, complete cds.
GenBankJX2359281e-147JX235928.1 Oryza sativa Japonica Group Myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560842.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX64e-78ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0Q3H6W10.0A0A0Q3H6W1_BRADI; Uncharacterized protein
STRINGBRADI1G44070.11e-173(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.12e-79myb domain protein 20